HPA026823

CASQ1 antibody from Atlas Antibodies
CASQ, PDIB1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026823
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026823, RRID:AB_10603557
Product name
Anti-CASQ1
Provider product page
Atlas Antibodies - HPA026823
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EHYKAFEDAAEEFHPYIPFFATFDSKVAKKLTLKL
NEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRR
STLRKLKPESMYETWE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -