Antibody data

Product number
H00000844-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000844-M01, RRID:AB_566287
Product name
CASQ1 monoclonal antibody (M01), clone 1D7
Provider product page
Abnova Corporation - H00000844-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CASQ1.
Antigen sequence
QEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLAL
LYHEPPEDDKASQRQFEMEELILELAAQVLEDKGV
GFGLVDSEKDAAVAKKLGLTEVDSMYVFKGDE
Isotype
IgG
Antibody clone number
1D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -