HPA007845

CASQ1 antibody from Sigma-Aldrich
CASQ, PDIB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007845, RRID:AB_1078388
Product name
Anti-CASQ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007845
Antibody type
Polyclonal
Antigen
Calsequestrin-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYH
EPPEDDKASQRQFEMEELILELAAQVLEDKGVGFG
LVDSEKDAAVAKKLGLTEVDSMYVFKGDEVIEYDG
EFSADTIVEFLLDVLEDPVELIEGERELQAFENIE
DEIKLIGY
Storage
-20C
Provider Type Product Number
- No reagents -