HPA026823

CASQ1 antibody from Sigma-Aldrich
CASQ, PDIB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026823
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026823, RRID:AB_10603557
Product name
Anti-CASQ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026823
Antibody type
Polyclonal
Antigen
calsequestrin 1 (fast-twitch, skeletal muscle) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHYKAFEDAAEEFHPYIPFFATFDSKVAKKLTLKL
NEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRR
STLRKLKPESMYETWE
Storage
-20C
Provider Type Product Number
- No reagents -