H00002273-M01
antibody from Abnova Corporation
Targeting: FHL1
bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002273-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002273-M01, RRID:AB_534866
- Product name
- FHL1 monoclonal antibody (M01), clone 2A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FHL1.
- Antigen sequence
DGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYK
NRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKC
TTREDSPKCKGCFKAIVAGDQNVEYKGT- Isotype
- IgG
- Antibody clone number
- 2A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Carbonic anhydrase III and four-and-a-half LIM protein 1 are preferentially oxidized with muscle unloading.
Chen CN, Ferrington DA, Thompson LV
Journal of applied physiology (Bethesda, Md. : 1985) 2008 Nov;105(5):1554-61
Journal of applied physiology (Bethesda, Md. : 1985) 2008 Nov;105(5):1554-61
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FHL1 monoclonal antibody (M01), clone 2A9. Western Blot analysis of FHL1 expression in Raw 264.7.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FHL1 expression in transfected 293T cell line by FHL1 monoclonal antibody (M01), clone 2A9.Lane 1: FHL1 transfected lysate(31.9 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FHL1 monoclonal antibody (M01), clone 2A9. Western Blot analysis of FHL1 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FHL1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol