H00002273-M05
antibody from Abnova Corporation
Targeting: FHL1
bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002273-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002273-M05, RRID:AB_1111841
- Product name
- FHL1 monoclonal antibody (M05), clone 2F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FHL1.
- Antigen sequence
DGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYK
NRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKC
TTREDSPKCKGCFKAIVAGDQNVEYKGT- Isotype
- IgG
- Antibody clone number
- 2F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Clinical significance of loss of Fhl1 expression in human gastric cancer.
Sakashita K, Mimori K, Tanaka F, Kamohara Y, Inoue H, Sawada T, Hirakawa K, Mori M
Annals of surgical oncology 2008 Aug;15(8):2293-300
Annals of surgical oncology 2008 Aug;15(8):2293-300
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FHL1 monoclonal antibody (M05), clone 2F7. Western Blot analysis of FHL1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FHL1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol