Explore
Validate
LearnABIN182991
antibody from antibodies-online
Targeting: FHL1
bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182991 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Four and A Half LIM Domains 1 (FHL1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FHL1 antibody: synthetic peptide directed towards the C terminal of human FHL1
- Reactivity
- Human, Mouse, Rat, Canine, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYE
GQSWH DYCFHCKKCS- Vial size
- 0.1 mg
Submitted references Atractylenolide I-mediated Notch pathway inhibition attenuates gastric cancer stem cell traits.
High prevalence of epigenetic inactivation of the human four and a half LIM domains 1 gene in human oral cancer.
Four and a half LIM protein 1C (FHL1C): a binding partner for voltage-gated potassium channel K(v1.5).
Identification of an FHL1 protein complex containing ACTN1, ACTN4, and PDLIM1 using affinity purifications and MS-based protein-protein interaction analysis.
Consequences of mutations within the C terminus of the FHL1 gene.
An X-linked myopathy with postural muscle atrophy and generalized hypertrophy, termed XMPMA, is caused by mutations in FHL1.
X-linked dominant scapuloperoneal myopathy is due to a mutation in the gene encoding four-and-a-half-LIM protein 1.
Skeletal muscle LIM protein 1 (SLIM1/FHL1) induces alpha 5 beta 1-integrin-dependent myocyte elongation.
Ma L, Mao R, Shen K, Zheng Y, Li Y, Liu J, Ni L
Biochemical and biophysical research communications 2014 Jul 18;450(1):353-9
Biochemical and biophysical research communications 2014 Jul 18;450(1):353-9
High prevalence of epigenetic inactivation of the human four and a half LIM domains 1 gene in human oral cancer.
Koike K, Kasamatsu A, Iyoda M, Saito Y, Kouzu Y, Koike H, Sakamoto Y, Ogawara K, Tanzawa H, Uzawa K
International journal of oncology 2013 Jan;42(1):141-50
International journal of oncology 2013 Jan;42(1):141-50
Four and a half LIM protein 1C (FHL1C): a binding partner for voltage-gated potassium channel K(v1.5).
Poparic I, Schreibmayer W, Schoser B, Desoye G, Gorischek A, Miedl H, Hochmeister S, Binder J, Quasthoff S, Wagner K, Windpassinger C, Malle E
PloS one 2011;6(10):e26524
PloS one 2011;6(10):e26524
Identification of an FHL1 protein complex containing ACTN1, ACTN4, and PDLIM1 using affinity purifications and MS-based protein-protein interaction analysis.
Sharma P, Shathasivam T, Ignatchenko V, Kislinger T, Gramolini AO
Molecular bioSystems 2011 Apr;7(4):1185-96
Molecular bioSystems 2011 Apr;7(4):1185-96
Consequences of mutations within the C terminus of the FHL1 gene.
Schoser B, Goebel HH, Janisch I, Quasthoff S, Rother J, Bergmann M, Müller-Felber W, Windpassinger C
Neurology 2009 Aug 18;73(7):543-51
Neurology 2009 Aug 18;73(7):543-51
An X-linked myopathy with postural muscle atrophy and generalized hypertrophy, termed XMPMA, is caused by mutations in FHL1.
Windpassinger C, Schoser B, Straub V, Hochmeister S, Noor A, Lohberger B, Farra N, Petek E, Schwarzbraun T, Ofner L, Löscher WN, Wagner K, Lochmüller H, Vincent JB, Quasthoff S
American journal of human genetics 2008 Jan;82(1):88-99
American journal of human genetics 2008 Jan;82(1):88-99
X-linked dominant scapuloperoneal myopathy is due to a mutation in the gene encoding four-and-a-half-LIM protein 1.
Quinzii CM, Vu TH, Min KC, Tanji K, Barral S, Grewal RP, Kattah A, Camaño P, Otaegui D, Kunimatsu T, Blake DM, Wilhelmsen KC, Rowland LP, Hays AP, Bonilla E, Hirano M
American journal of human genetics 2008 Jan;82(1):208-13
American journal of human genetics 2008 Jan;82(1):208-13
Skeletal muscle LIM protein 1 (SLIM1/FHL1) induces alpha 5 beta 1-integrin-dependent myocyte elongation.
McGrath MJ, Mitchell CA, Coghill ID, Robinson PA, Brown S
American journal of physiology. Cell physiology 2003 Dec;285(6):C1513-26
American journal of physiology. Cell physiology 2003 Dec;285(6):C1513-26
No comments: Submit comment
No validations: Submit validation data