HPA001391
antibody from Atlas Antibodies
Targeting: FHL1
bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001391 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001391, RRID:AB_1848542
- Product name
- Anti-FHL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGK
GSSVVAYEGQSWHDYCFHCKIRRAPPLSNN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references From Gene Expression Analysis to Tissue Microarrays: A Rational Approach to Identify Therapeutic and Diagnostic Targets in Lymphoid Malignancies
Ek S
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
Molecular & Cellular Proteomics 2006 March;5(6):1072-1081
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-FHL1 antibody. Corresponding FHL1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows low expression as expected.
- Sample type
- HUMAN