HPA001391

FHL1 antibody from Atlas Antibodies
bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001391
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001391, RRID:AB_1848542
Product name
Anti-FHL1
Provider product page
Atlas Antibodies - HPA001391
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGK
GSSVVAYEGQSWHDYCFHCKIRRAPPLSNN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -