HPA001391

FHL1 antibody from Sigma-Aldrich
bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001391
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001391, RRID:AB_1848542
Product name
Anti-FHL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001391
Antibody type
Polyclonal
Antigen
Four and a half LIM domains protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGK
GSSVVAYEGQSWHDYCFHCKIRRAPPLSNN
Storage
-20C
Provider Type Product Number
- No reagents -