HPA022030

antibody from Atlas Antibodies

Targeting: MECR CGI-63, ETR1, FASN2B, NRBF1

Antibody data

Submit

Validation data

Product number: HPA022030 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA022030, RRID:AB_1853716
Product name: Anti-MECR
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKM LAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQV VAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEE ALIQV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MECR protein structure - HPA022030 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-MECR antibody HPA022030 (A) shows similar protein distribution across tissues to independent antibody HPA022018 (B).
Antibody #2 product nr: HPA028740, HPA022018
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MECR antibody HPA022030.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-MECR antibody HPA022030.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MECR antibody HPA022030.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MECR antibody HPA022030.
Sample type: HUMAN