H00051102-B01P

MECR antibody from Abnova Corporation
CGI-63, ETR1, FASN2B, NRBF1

Antibody data

Product number
H00051102-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051102-B01P, RRID:AB_1577108
Product name
MECR purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00051102-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MECR protein.
Antigen sequence
MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYS
ASAEPARVRALVYGHHGDPAKVVELKNLELAAVRG
SDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGG
NEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRT
EAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRML
MDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLR
TINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRP
EMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGG
TMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQW
KKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPL
QDYQSALEASMKPFISSKQILTM
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -