HPA022018

MECR antibody from Sigma-Aldrich
CGI-63, FASN2B, NRBF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022018
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022018, RRID:AB_1853714
Product name
Anti-MECR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022018
Antibody type
Polyclonal
Antigen
Trans-2-enoyl-CoA reductase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVI
QNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQK
LSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPR
LALNCV
Storage
-20C
Provider Type Product Number
- No reagents -