H00054507-B01

ADAMTSL4 antibody from Abnova Corporation
DKFZP434K1772, TSRC1

Antibody data

Product number
H00054507-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054507-B01, RRID:AB_1112980
Product name
ADAMTSL4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00054507-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ADAMTSL4 protein.
Antigen sequence
MPAPPHPRTPLGSPAAYWKRVGHSACSASCGKGVW
RPIFLCISRESGEELDERSCAAGARPPASPEPCHG
TPCPPYWEAGEWTSCSRSCGPGTQHRQLQCRQEFG
GGGSSVPPERCGHLPRPNITQSCQLRLCGHWEVGS
PWSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECAS
GPPQPPSREACDMGPCTTAWFHSDWSSKCSAECGT
GIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGS
RPPDMRACSLGPCERTWRWYTGPWGECSSECGSGT
QRRDIICVSKLGTEFNVTSPSNCSHLPRPPALQPC
QGQACQDRWFSTPWSPCSRSCQGGTQTREVQCLST
NQTLSTRCPPQLRPSRKRPCNSQPCSQRPDDQCKD
SSPHCPLVVQARLCVYPYYTATCCRSCAHVLERSP
QDPS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -