HPA006279

ADAMTSL4 antibody from Atlas Antibodies
DKFZP434K1772, TSRC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006279
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006279, RRID:AB_887618
Product name
Anti-ADAMTSL4
Provider product page
Atlas Antibodies - HPA006279
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ISSPPPILENPTPEPPVPQLQPEILRVEPPLAPAP
RPARTPGTLQRQVRIPQMPAPPHPRTPLGSPAAYW
KRVGHSACSASCGKGVWRPIFLCISRESGEELDER
S
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -