HPA006279

ADAMTSL4 antibody from Sigma-Aldrich
DKFZP434K1772, TSRC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006279
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006279, RRID:AB_1078102
Product name
Anti-ADAMTSL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006279
Antibody type
Polyclonal
Antigen
ADAMTS-like protein 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ISSPPPILENPTPEPPVPQLQPEILRVEPPLAPAP
RPARTPGTLQRQVRIPQMPAPPHPRTPLGSPAAYW
KRVGHSACSASCGKGVWRPIFLCISRESGEELDER
S
Storage
-20C
Provider Type Product Number
- No reagents -