SAB1401728

ADAMTSL4 antibody from MilliporeSigma / Merck KGaA
DKFZP434K1772, TSRC1
Immunocytochemistry
Recommended by provider

Antibody data

Product number
SAB1401728
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401728, RRID:AB_10609669
Product name
Anti-ADAMTSL4 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401728
Antibody type
Polyclonal
Antigen
ADAMTSL4 (AAH27478.1, 1 a.a. ~ 424 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MPAPPHPRTPLGSPAAYWKRVGHSACSASCGKGVW
RPIFLCISRESGEELDERSCAAGARPPASPEPCHG
TPCPPYWEAGEWTSCSRSCGPGTQHRQLQCRQEFG
GGGSSVPPERCGHLPRPNITQSCQLRLCGHWEVGS
PWSQCSVRCGRGQRSRQVRCVGNNGDEVSEQECAS
GPPQPPSREACDMGPCTTAWFHSDWSSKCSAECGT
GIQRRSVVCLGSGAALGPGQGEAGAGTGQSCPTGS
RPPDMRACSL
Storage
-20C
Provider Type Product Number
- No reagents -