HPA008527

FHDC1 antibody from Sigma-Aldrich
KIAA1727
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008527
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008527, RRID:AB_2104099
Product name
Anti-FHDC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008527
Antibody type
Polyclonal
Antigen
FH2 domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EHELVTGLAQFNLQGSQGMEETSQLTLSDFSPMEL
ESVGHRGPQSLSASSSSLTPMGRDALGSLSPALED
GKAAPDEPGSAALGSVGSSDPENKDPRPLFCISDT
TDCSLTLDCSEGTDSRPRGGDPEEGGEGDGSMSSG
V
Storage
-20C
Provider Type Product Number
- No reagents -