HPA006281

PI4KB antibody from Atlas Antibodies
PI4K-BETA, pi4K92, PIK4CB
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006281
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006281, RRID:AB_1079614
Product name
Anti-PI4KB
Provider product page
Atlas Antibodies - HPA006281
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYG
HLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIW
EQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQ
VKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQS
CAGY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -