HPA006280

PI4KB antibody from Sigma-Aldrich
PI4K-BETA, pi4K92, PIK4CB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006280
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006280, RRID:AB_1079613
Product name
Anti-PI4KB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006280
Antibody type
Polyclonal
Antigen
Phosphatidylinositol 4-kinase beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLPTKEQKTQRLISELSLLNHKLPARVWLPTAGFD
HHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFD
TTSVPARIPENRIRSTRSVENLPECGITHEQRAGS
FSTVPNYD
Storage
-20C
Provider Type Product Number
- No reagents -