HPA006281

PI4KB antibody from MilliporeSigma / Merck KGaA
PI4K-BETA, pi4K92, PIK4CB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006281
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006281, RRID:AB_1079614
Product name
Anti-PI4KB antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006281
Antibody type
Polyclonal
Antigen
Phosphatidylinositol 4-kinase beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYG
HLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIW
EQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQ
VKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQS
CAGY
Storage
-20C
Provider Type Product Number
- No reagents -