HPA062833

CAND1 antibody from Atlas Antibodies
DKFZp434M1414, KIAA0829, TIP120, TIP120A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA062833
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA062833, RRID:AB_2684876
Product name
Anti-CAND1
Provider product page
Atlas Antibodies - HPA062833
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKA
LHKQMKEKSVKTRQCCFNMLTELVNVLPG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -