H00055832-M04

CAND1 antibody from Abnova Corporation
DKFZp434M1414, KIAA0829, TIP120, TIP120A

Antibody data

Product number
H00055832-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055832-M04, RRID:AB_894022
Product name
CAND1 monoclonal antibody (M04), clone 4D10
Provider product page
Abnova Corporation - H00055832-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CAND1.
Antigen sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQ
KDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVK
CLGPLVSKVKEYQVETIVDTLCTNMLSDKE
Isotype
IgG
Antibody clone number
4D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -