H00055832-M04
antibody from Abnova Corporation
Targeting: CAND1
DKFZp434M1414, KIAA0829, TIP120, TIP120A
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055832-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055832-M04, RRID:AB_894022
- Product name
- CAND1 monoclonal antibody (M04), clone 4D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CAND1.
- Antigen sequence
MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQ
KDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVK
CLGPLVSKVKEYQVETIVDTLCTNMLSDKE- Isotype
- IgG
- Antibody clone number
- 4D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CAND1 monoclonal antibody (M04), clone 4D10. Western Blot analysis of CAND1 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CAND1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol