HPA055748

CAND1 antibody from Atlas Antibodies
DKFZp434M1414, KIAA0829, TIP120, TIP120A

Antibody data

Product number
HPA055748
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055748, RRID:AB_2682905
Product name
Anti-CAND1
Provider product page
Atlas Antibodies - HPA055748
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DALSCLYVILCNHSPQVFHPHVQALVPPVVACVGD
PFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYI
KDLFTCT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -