AV35825

ZNF79 antibody from Sigma-Aldrich
pT7
No application information provided.

Antibody data

Product number
AV35825
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35825, RRID:AB_1859456
Product name
Anti-ZNF79 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35825
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF79 with an internal ID of P07077
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPGWKIISGSPPEQALSEASFQDPCVEMPPGDSDH
GTSDLEKSFNLRPVL
Storage
-20C
Provider Type Product Number
- No reagents -