HPA008579

MRPL9 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008579
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008579, RRID:AB_1079412
Product name
Anti-MRPL9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008579
Antibody type
Polyclonal
Antigen
39S ribosomal protein L9, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAPDLACNFSLSQNRGTVIVERWWKVPLAGEGRKP
RLHRRHRVYKLVEDTKHRPKENLELILTQSVENVG
VRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFE
EEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGM
KNNV
Storage
-20C
Provider Type Product Number
- No reagents -