H00007205-M07
antibody from Abnova Corporation
Targeting: TRIP6
MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP1, ZRP-1
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007205-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007205-M07, RRID:AB_1137512
- Product name
- TRIP6 monoclonal antibody (M07), clone 3D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TRIP6.
- Antigen sequence
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHG
AALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVG
SHGVLQHTQGLPADRGGLRPGSLDAEIDLL- Isotype
- IgG
- Antibody clone number
- 3D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TRIP6 expression in transfected 293T cell line by TRIP6 monoclonal antibody (M07), clone 3D12.Lane 1: TRIP6 transfected lysate(50.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TRIP6 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of TRIP6 transfected lysate using anti-TRIP6 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TRIP6 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol