HPA006514

JTB antibody from Sigma-Aldrich
hJT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006514
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006514, RRID:AB_1079164
Product name
Anti-JTB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006514
Antibody type
Polyclonal
Antigen
Protein JTB precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKT
TPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
Storage
-20C
Provider Type Product Number
- No reagents -