H00009785-M02

DHX38 antibody from Abnova Corporation
DDX38, hPrp16, KIAA0224, PRP16, PRPF16

Antibody data

Product number
H00009785-M02
Provider
Abnova Corporation
Product name
DHX38 monoclonal antibody (M02), clone 3B9
Provider product page
Abnova Corporation - H00009785-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DHX38.
Antigen sequence
YSSEDYVRRREQHLHKQKQKRISAQRRQINEDNER
WETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHN
LVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARK
GSQT
Isotype
IgG
Antibody clone number
3B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -