HPA041347

DHX38 antibody from Atlas Antibodies
DDX38, hPrp16, KIAA0224, PRP16, PRPF16
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041347
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041347, RRID:AB_10796571
Product name
Anti-DHX38
Provider product page
Atlas Antibodies - HPA041347
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRI
SAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFE
EDNAAKVHLMVHNLVPPFLDGRIVFTKQPE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -