HPA041604

DHX38 antibody from Atlas Antibodies
DDX38, hPrp16, KIAA0224, PRP16, PRPF16

Antibody data

Product number
HPA041604
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041604, RRID:AB_2677577
Product name
Anti-DHX38
Provider product page
Atlas Antibodies - HPA041604
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IPVKDATSDLAIIARKGSQTVRKHREQKERKKAQH
KHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYR
TEQKFADHMKRKSEASSEFAKKKSIL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -