PAB23787

DHX38 antibody from Abnova Corporation
DDX38, hPrp16, KIAA0224, PRP16, PRPF16

Antibody data

Product number
PAB23787
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23787, RRID:AB_11123652
Product name
DHX38 polyclonal antibody
Provider product page
Abnova Corporation - PAB23787
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant DHX38.
Antigen sequence
MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRI
SAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFE
EDNAAKVHLMVHNLVPPFLDGRIVFTKQPE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -