ARP36411_P050

antibody from Aviva Systems Biology

Targeting: DHX38 DDX38, hPrp16, KIAA0224, PRP16, PRPF16

Antibody data

Submit

Validation data

Product number: ARP36411_P050 - Provider product page
Provider: Aviva Systems Biology
Proper citation: Aviva Systems Biology Cat#ARP36411_P050, RRID:AB_10863791
Product name: Dhx38 antibody - N-terminal region (ARP36411_P050)
Antibody type: Polyclonal
Antigen: Synthetic peptide
Description: This is a rabbit polyclonal antibody against Dhx38. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Reactivity: Human, Rat
Host: Rabbit
Antigen sequence: VRSKSSDDTPLPTPSYKYNEWADDRRHLGSTPRLS RGRGRREDGEEGIAF
Vial size: 50 µg
Concentration: 1 mg/ml
Handling: Add 50 µl of distilled water. Final anti-Dhx38 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

DHX38 protein structure - ARP36411_P050 shown in red.