Antibody data

Product number
H00051442-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051442-M01, RRID:AB_1581850
Product name
VGLL1 monoclonal antibody (M01), clone 3C7
Provider product page
Abnova Corporation - H00051442-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant VGLL1.
Antigen sequence
MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQG
DISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLK
NDDSMSPNQWRYSSPWTKPQPEVPVTNRAA
Isotype
IgG
Antibody clone number
3C7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -