HPA006935

SLC27A3 antibody from Sigma-Aldrich
ACSVL3, FATP3, MGC4365
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006935
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006935, RRID:AB_1080003
Product name
Anti-SLC27A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006935
Antibody type
Polyclonal
Antigen
Long-chain fatty acid transport protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEAERESNRAARAFLRALGWDWGPDGGDSGEGSAG
EGERAAPGAGDAAAGSGAEFAGGDGAARGGGAAAP
LSPGATVALLLPAGPEFLWLWFGLAKAGLRTAFVP
TALRRGPLLHCLRSCGARALVLAPGKAGAP
Storage
-20C
Provider Type Product Number
- No reagents -