Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003059-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003059-M01, RRID:AB_489968
- Product name
- HCLS1 monoclonal antibody (M01), clone 3D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HCLS1.
- Antigen sequence
QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISS
EAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLP
EDNEEPPALPPRTLEGLQVE- Isotype
- IgG
- Antibody clone number
- 3D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization.
Kan CY, Wen VW, Pasquier E, Jankowski K, Chang M, Richards LA, Kavallaris M, MacKenzie KL
Oncogene 2012 Nov 15;31(46):4815-27
Oncogene 2012 Nov 15;31(46):4815-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HCLS1 monoclonal antibody (M01), clone 3D5 Western Blot analysis of HCLS1 expression in K-562 ( Cat # L009V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HCLS1 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to HCLS1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol