H00005313-M10

PKLR antibody from Abnova Corporation
No application information provided.

Antibody data

Product number
H00005313-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005313-M10, RRID:AB_1578842
Product name
PKLR monoclonal antibody (M10), clone 4C9
Provider product page
Abnova Corporation - H00005313-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PKLR.
Antigen sequence
SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYRE
PPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIV
VTGWRPGSGYTNIMRVLSIS
Isotype
IgG
Antibody clone number
4C9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -