Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005313-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005313-B01P, RRID:AB_1578845
- Product name
- PKLR purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human PKLR protein.
- Antigen sequence
MSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGP
AGYLRRASVAQLTQELGTAFFQQQQLPAAMADTFL
EHLCLLDIDSEPVAARSTSIIATIGPASRSVERLK
EMIKAGMNIARLNFSHGSHEYHAESIANVREAVES
FAGSPLSYRPVAIALDTKGPEIRTGILQGGPESEV
ELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRV
VPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGV
LGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGV
DIVFASFVRKASDVAAVRAALGPEGHGIKIISKIE
NHEGVKRFDEILEVSDGIMVARGDLGIEIPAEKVF
LAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTR
AETSDVANAVLDGADCIMLSGETAKGNFPVEAVKM
QHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVT
AIGAVEAAFKCCAAAIIVLTTTGRSAQLLSRYRPR
AAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIW
ADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRP
GSGYTNIMRVLSIS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PKLR MaxPab polyclonal antibody. Western Blot analysis of PKLR expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PKLR expression in transfected 293T cell line (H00005313-T01) by PKLR MaxPab polyclonal antibody.Lane 1: PKLR transfected lysate(63.14 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of purified MaxPab antibody to PKLR on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol