HPA011991

PKLR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011991
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011991, RRID:AB_1855439
Product name
Anti-PKLR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011991
Antibody type
Polyclonal
Antigen
Pyruvate kinase isozymes R/L recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LFEELRRAAPLSRDPTEVTAIGAVEAAFKCCAAAI
IVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQV
HLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGK
LRGFLRVGDLVIVVTGWRPGSGYTNIMRVLS
Storage
-20C
Provider Type Product Number
- No reagents -