HPA024132

UFSP1 antibody from Sigma-Aldrich
UFSP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024132, RRID:AB_1858594
Product name
Anti-UFSP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024132
Antibody type
Polyclonal
Antigen
Inactive Ufm1-specific protease 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KALLGVCVGSGTEAYVLVLDPHYWGTPKSPSELQA
AGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRTL
D
Storage
-20C
Provider Type Product Number
- No reagents -