HPA027099

UFSP1 antibody from Sigma-Aldrich
UFSP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027099
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027099, RRID:AB_2214069
Product name
Anti-UFSP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027099
Antibody type
Polyclonal
Antigen
UFM1-specific peptidase 1 (non-functional) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLH
GELERLYSHFAGGGGPVMVGGDADARS
Storage
-20C
Provider Type Product Number
- No reagents -