Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019704 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-ACHE
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein fragment
- Description
- Affinity purified using the antigen as affinity ligand.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVV
LHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQL
AGRLAAQGARVYAYVFEHRAS- Isotype
- IgG
- Vial size
- 110µl
- Concentration
- 0.14 mg/ml
- Storage
- For continuous use, store at 2-8°C for one-two days. For extended storage, store in -20°C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Handling
- The antibody solution should be gently mixed before use.
Submitted references Ntrk1 mutation co-segregating with bipolar disorder and inherited kidney disease in a multiplex family causes defects in neuronal growth and depression-like behavior in mice
Genome-Wide DNA Methylation Scan in Major Depressive Disorder
Neurochemical Characterization of the Tree Shrew Dorsal Striatum
Nakajima K, Miranda A, Craig D, Shekhtman T, Kmoch S, Bleyer A, Szelinger S, Kato T, Kelsoe J
Translational Psychiatry 2020;10(1)
Translational Psychiatry 2020;10(1)
Genome-Wide DNA Methylation Scan in Major Depressive Disorder
Kato T, Sabunciyan S, Aryee M, Irizarry R, Rongione M, Webster M, Kaufman W, Murakami P, Lessard A, Yolken R, Feinberg A, Potash J, Consortium G
PLoS ONE 2012;7(4):e34451
PLoS ONE 2012;7(4):e34451
Neurochemical Characterization of the Tree Shrew Dorsal Striatum
Perez-Costas E, Melendez-Ferro M, Roberts R, Rice M
Frontiers in Neuroanatomy 2011;5
Frontiers in Neuroanatomy 2011;5
No comments: Submit comment
No validations: Submit validation data