HPA027424

PUM1 antibody from Sigma-Aldrich
KIAA0099, PUMH1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027424
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027424, RRID:AB_10602918
Product name
Anti-PUM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027424
Antibody type
Polyclonal
Antigen
pumilio homolog 1 (Drosophila) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGD
LKEEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQ
NSANEVDLLGPN
Storage
-20C
Provider Type Product Number
- No reagents -