Antibody data

Product number
H00004817-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004817-M01, RRID:AB_1679004
Product name
NIT1 monoclonal antibody (M01), clone 1C3
Provider product page
Abnova Corporation - H00004817-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NIT1.
Antigen sequence
AFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRH
HEKRASYGHSMVVDPWGTVVARCSEGPGLCLARID
LNYLRQLRRHLPVFQHRRPDLYGNLGHPLS
Isotype
IgG
Antibody clone number
1C3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -