HPA006657

NIT1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006657
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006657, RRID:AB_1079485
Product name
Anti-NIT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006657
Antibody type
Polyclonal
Antigen
Nitrilase homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLSLLCPGLRIPQLSVLCAQPRPRAMAISSSSCEL
PLVAVCQVTSTPDKQQNFKTCAELVREAARLGACL
AFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQL
ARECGLWLSLGGFHERGQDWEQT
Storage
-20C
Provider Type Product Number
- No reagents -