SAB1401264

NIT1 antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
SAB1401264
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1401264, RRID:AB_10609855
Product name
Monoclonal Anti-NIT1 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1401264
Antibody type
Monoclonal
Antigen
NIT1 (NP_005591, 228 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
AFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRH
HEKRASYGHSMVVDPWGTVVARCSEGPGLCLARID
LNYLRQLRRHLPVFQHRRPDLYGNLGHPLS*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -