HPA001236

PLOD3 antibody from Sigma-Aldrich
LH3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001236
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001236, RRID:AB_1855474
Product name
Anti-PLOD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001236
Antibody type
Polyclonal
Antigen
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGN
YVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAV
FVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEV
FHEPHIADSWPQLQDHFSAVKLVGPEEAL
Storage
-20C
Provider Type Product Number
- No reagents -