HPA006700

PSMB4 antibody from Sigma-Aldrich
HN3, PROS26
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006700
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006700, RRID:AB_1079704
Product name
Anti-PSMB4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006700
Antibody type
Polyclonal
Antigen
Proteasome subunit beta type 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNP
LWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATG
YGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRV
LYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWD
IA
Storage
-20C
Provider Type Product Number
- No reagents -