PAB21108

NKAIN1 antibody from Abnova Corporation
FAM77C, FLJ12650

Antibody data

Product number
PAB21108
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21108, RRID:AB_10987398
Product name
NKAIN1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21108
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant NKAIN1.
Antigen sequence
DRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLA
LEDHHVISVTGCLLDYPY
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -