HPA006873

NKAIN1 antibody from Atlas Antibodies
FAM77C, FLJ12650
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006873
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006873, RRID:AB_1848410
Product name
Anti-NKAIN1
Provider product page
Atlas Antibodies - HPA006873
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLA
LEDHHVISVTGCLLDYPY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -