HPA006873

NKAIN1 antibody from MilliporeSigma / Merck KGaA
FAM77C, FLJ12650
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006873
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006873, RRID:AB_1848410
Product name
Anti-NKAIN1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006873
Antibody type
Polyclonal
Antigen
Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLA
LEDHHVISVTGCLLDYPY
Storage
-20C
Provider Type Product Number
- No reagents -